PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00385.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 368aa    MW: 40923.5 Da    PI: 6.7591
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00385.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.81.5e-10190248563
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                              kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l  l+  +  l  e+
  Rsa1.0_00385.1_g00001.1 190 KRAKRIWANRQSAARSKERKTRYIFELERKVQTLQTEATTLSAQLTLLQRDANGLSVEN 248
                              9********************************************99998887776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-13186250IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.507188251IPR004827Basic-leucine zipper domain
PfamPF001707.2E-9190241IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.25E-10190240No hitNo description
Gene3DG3DSA:1.20.5.1702.3E-11190244No hitNo description
CDDcd147032.38E-22191240No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MDKEKSPAPC GGRLPPPSPS GRCSPFSDMS RMLEHPPKKI GHRRAHSEIL TLPDDLSFDF  60
DLGLVGNGSG TNADVPSFSD DTEGGGDLLS MYLDMDKFNS STATSSSAAQ VGEPSGTAWK  120
NELVVTHTGS TSSNHQNSSF GERPRVRHQH SHSMDGSLSI SEMLMSGNED DAKKSISAAK  180
LAELALIDPK RAKRIWANRQ SAARSKERKT RYIFELERKV QTLQTEATTL SAQLTLLQRD  240
ANGLSVENNE LKLRLQTMEQ KVHLQDELNE ALKEEIQHLK VLTGQVAAPN GASSAMNYGS  300
FGSNQQLYSN NHQSMQTMLA AQQLQQLQIH SQKQQQQEFQ FQQQQQFLHH RLRQQEQQNG  360
IAEMEKTE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006410269.10.0hypothetical protein EUTSA_v10016790mg
RefseqXP_006410270.10.0hypothetical protein EUTSA_v10016790mg
SwissprotQ040880.0POF21_ARATH; Probable transcription factor PosF21
TrEMBLE4MXN60.0E4MXN6_EUTHA; mRNA, clone: RTFL01-24-D07
TrEMBLV4M9E90.0V4M9E9_EUTSA; Uncharacterized protein
STRINGAT2G31370.11e-180(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24452772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31370.51e-139bZIP family protein